Engadget Japanese RSS Feed RSS feed analytics

Engadget Japanese

https://feeds.feedburner.com/engadget/japanese
Technology Japanese RSS or Atom
Follow in Inoreader Claim this feed Check another feed
Top 1%of technology feeds
1kreaders in Inoreader
0posts a week
1 weekcheck interval

Audience

Readers since 2014, against other technology feeds in Inoreader

Top 1% of technology feeds in Inoreader

About the same place as a year ago.

2014201620182020202220242026
This feed Median Middle half Top 25% to 10% Top 10% to 1%

Publishing schedule

No new posts reached Inoreader in the last 30 days.

Delivery

48h success rate
0%
Not modified (304)
0%
Check interval
1 week
Real-time delivery
No
Full report in the feed validator

Topics

technologygadgetspcit-newslifehacksdecorationhardwareandroid

Readers also follow

More feeds from engadget.com

Publisher analytics

Claim the feed with a code in the feed or on the site's domain and see the full subscriber history with the follows and unfollows of every week, which posts readers save, like, share and highlight, where new readers came from, 30 days of delivery checks, email alerts when the feed breaks, CSV downloads, and tips that make the feed look better in Inoreader. It is free.

Claim this feed

Request removal